DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and mnx2b

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001315287.1 Gene:mnx2b / 406206 ZFINID:ZDB-GENE-040415-2 Length:328 Species:Danio rerio


Alignment Length:325 Identity:111/325 - (34%)
Similarity:146/325 - (44%) Gaps:87/325 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 QPKKSFCIDALLAKSQHQ-SGEPQPIIVDDRLAALHYARDQAELNHAFVTASNAAAAAQAAASAA 279
            :..|:|.||||||:..|: |.|..|                                        
Zfish     2 EKSKNFRIDALLAEEPHRGSREVSP---------------------------------------- 26

  Fly   280 GGISEQEALQRIRDSREYDSPSPDGMSRSESPTSSHRSSPPISPGCEDQQQPHGALHPQHLSMRM 344
             |:|...........|..|:|||.|     :|.:.| ..|.|.|      :| |.|:..|..  :
Zfish    27 -GLSSDSPTGSPVSCRRGDTPSPRG-----TPGAIH-LQPGIIP------KP-GLLNLPHPG--L 75

  Fly   345 SDFHDEFKKPIPPHSPIRPQDFPLYAGGHPYQLLAQGGSAFHRPLDPSGKPIPIPMGHNFMPSQL 409
            :.....:..|:.|.|.:        .|.||  .||..|      .....:|.|..:....|...|
Zfish    76 TSIPGMYTTPMYPISAL--------GGQHP--ALAYTG------FTQLTQPYPEQLKAAAMAGSL 124

  Fly   410 QFEFLARAGMLHHRIPELA--------AYPHHAILGKTRRPRTAFTSQQLLELEKQFKQNKYLSR 466
            ..|...|||::..|:|:..        ..|...::||.||||||||||||||||.|||.||||||
Zfish   125 PLEHWIRAGIMVPRLPDYTCEWGSIQMTAPQSGLMGKCRRPRTAFTSQQLLELENQFKLNKYLSR 189

  Fly   467 PKRFEVASGLMLSETQVKIWFQNRRMKWKRSKKAQQEA------KERAKANQQQQQQQQTPSAAS 525
            |||||||:.|||:||||||||||||||||||:||:::|      ::|.......:..::.|:|.|
Zfish   190 PKRFEVATSLMLTETQVKIWFQNRRMKWKRSRKAKEQAAQVEVERQRGGTKPSGRDSRRAPAAPS 254

  Fly   526  525
            Zfish   255  254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 47/52 (90%)
mnx2bNP_001315287.1 Homeobox 165..218 CDD:278475 47/52 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 109 1.000 Domainoid score I6296
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm25311
orthoMCL 1 0.900 - - OOG6_107775
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3748
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.670

Return to query results.
Submit another query.