DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and mnx2a

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001009886.2 Gene:mnx2a / 406205 ZFINID:ZDB-GENE-040415-1 Length:309 Species:Danio rerio


Alignment Length:293 Identity:103/293 - (35%)
Similarity:132/293 - (45%) Gaps:85/293 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 KSFCIDALLAKSQHQ--SGEPQPIIVDDRLAALHYARDQAELNHAFVTASNAAAAAQAAASAAGG 281
            |:|.|||||::|..|  .|: .|.:..:.:......|.:..|..||...:...            
Zfish     5 KNFRIDALLSESSQQIVRGD-SPGLCSEGVDVDMCKRTENSLPRAFQLQTGVI------------ 56

  Fly   282 ISEQEALQRIRDSREYDSPSPDGMSRSESP--TS-SHRSSPPISPGCEDQQQPHGALHPQHLSMR 343
                              |.| ||.....|  || |..|.|.:.|.........||.||      
Zfish    57 ------------------PKP-GMLNISHPGLTSLSQGSMPGMYPSPMYSITALGAQHP------ 96

  Fly   344 MSDFHDEFKKPIPPHSPIRPQDFPLYAGGHPYQLLAQGGSAFHRPLDPSGKPIPIPMGHNFMPSQ 408
             |..:..|.:|.|.|                .:..|..||              :|:.|      
Zfish    97 -SFAYSGFTQPYPDH----------------LKAAAMAGS--------------LPLEH------ 124

  Fly   409 LQFEFLARAGMLHHRIPELAAYPHHAILGKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVA 473
                 ..|||::..|:.:.:..|...::||.||||||||||||||||.|||.|||||||||||||
Zfish   125 -----WLRAGLIMPRLADYSGAPQSGLIGKCRRPRTAFTSQQLLELENQFKLNKYLSRPKRFEVA 184

  Fly   474 SGLMLSETQVKIWFQNRRMKWKRSKKAQQEAKE 506
            :.|||:||||||||||||||||||:||:::|.:
Zfish   185 TSLMLTETQVKIWFQNRRMKWKRSRKAKEQAAQ 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 47/52 (90%)
mnx2aNP_001009886.2 Homeobox 153..206 CDD:278475 47/52 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 109 1.000 Domainoid score I6296
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm25311
orthoMCL 1 0.900 - - OOG6_107775
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3748
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.670

Return to query results.
Submit another query.