DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and mnx1

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001009885.1 Gene:mnx1 / 405399 ZFINID:ZDB-GENE-040409-1 Length:311 Species:Danio rerio


Alignment Length:343 Identity:119/343 - (34%)
Similarity:156/343 - (45%) Gaps:104/343 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 QPKKSFCIDALLAKSQHQSGEPQPIIVDDRLAALHYARDQAELNHAFVTA--SNAAAAAQAAASA 278
            :..|:|.||||||....:. :..|:                    |.||:  :::.:::..:..|
Zfish     2 EKSKNFRIDALLAVDPPKV-QTSPL--------------------ALVTSLPTSSISSSSDSVQA 45

  Fly   279 AGGISEQEALQRIRDSREYDSPSPDGMSRSESPTSSHRSSPPISPGCEDQQQPHGALHPQHLSMR 343
            ....:..:|||                  :|||      |||....|....:| |.|:..|..  
Zfish    46 VELTTNSDALQ------------------TESP------SPPRISSCGLIPKP-GFLNSPHSG-- 83

  Fly   344 MSDFHDEFKKPIPPHSPIRPQDFPLYAGGHP---YQLLA------------QGGSAFHRPLDPSG 393
            |...|.:....|||.:        ||  |||   |...|            .|....|.|.||. 
Zfish    84 MVGLHPQSSTGIPPQA--------LY--GHPMYTYSAAALGQHPALSYSYPHGSHHHHHPSDPL- 137

  Fly   394 KPIPIPMGHNFMPSQLQFEFLAR---AGMLHHRIPELAAYPHHA---ILGKTRRPRTAFTSQQLL 452
                     ....|..|.:...|   |||:   :|::|.:...|   :|||.|||||||||||||
Zfish   138 ---------KLTASSFQLDHWLRVSTAGMM---LPKMADFNGQAQSNLLGKCRRPRTAFTSQQLL 190

  Fly   453 ELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKKAQQEA-----KERAKANQ 512
            |||.|||.|||||||||||||:.|||:|||||||||||||||||||||:::|     |::.|.|.
Zfish   191 ELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSKKAKEQAAQDAEKQKGKGNH 255

  Fly   513 Q-----QQQQQQTPSAAS 525
            .     ::..|:..|..|
Zfish   256 DKMDGLEKDYQKVDSGKS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 47/52 (90%)
mnx1NP_001009885.1 Homeobox 180..233 CDD:278475 47/52 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 109 1.000 Domainoid score I6296
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm25311
orthoMCL 1 0.900 - - OOG6_107775
Panther 1 1.100 - - LDO PTHR24335
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5619
SonicParanoid 1 1.000 - - X3748
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.