DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and CG9876

DIOPT Version :10

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster


Alignment Length:69 Identity:31/69 - (44%)
Similarity:47/69 - (68%) Gaps:2/69 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   432 HHAILGKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKR 496
            ||:  .|.||.||.|:|.||..|||.|::..|.....|.|:|:.:.|||.:|::||||||.|::|
  Fly   112 HHS--RKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRR 174

  Fly   497 SKKA 500
            ::::
  Fly   175 NERS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeodomain 440..496 CDD:459649 27/55 (49%)
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 27/55 (49%)

Return to query results.
Submit another query.