DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and Gsx2

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001131035.2 Gene:Gsx2 / 364140 RGDID:1308047 Length:305 Species:Rattus norvegicus


Alignment Length:426 Identity:103/426 - (24%)
Similarity:140/426 - (32%) Gaps:178/426 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 SHPPPPHPRLYVEGFP-PPHHVPHPHPALGTYPLPRLPLMLPANPPGVPSGAAAPPPVSPQPAAN 195
            |.|.|..|    |..| |...:|...|:         ||::..:.||.||..:....|.|....:
  Rat    16 SRPAPSLP----ESHPGPDFFIPLGMPS---------PLVMSVSGPGCPSRKSGAFCVCPLCVTS 67

  Fly   196 HLSHS--------------GATMA------TTTLLPPAQSQ-----PKKSFCIDALLAKSQHQSG 235
            ||..|              ||.:|      .|..||..:||     ....||  ..::.:.|...
  Rat    68 HLHSSRPPAGAGGGATGTAGAAVAGGGVAGGTGALPLLKSQFSPGPGDAQFC--PRVSHAHHHHH 130

  Fly   236 EPQPIIVDDRLAALHYARDQAELNHAFVTASNAAAAAQAAASAAGGISEQEALQRIRDSREYDSP 300
            .||.          |:...|.:...:...|:.|||||.|||:|.|                    
  Rat   131 APQH----------HHHHHQPQQPGSAAAAAAAAAAAAAAAAALG-------------------- 165

  Fly   301 SPDGMSRSESPTSSHRSSPPISPGCEDQQQPHGALHPQHLSMRMSDFHDEFKKPIPPHSPIRPQD 365
                                               ||||                  |:|:....
  Rat   166 -----------------------------------HPQH------------------HAPVCAAT 177

  Fly   366 FPLYAGGHPYQLLAQGGSAFHRPLDPSGKPIPIPMGHNFMPSQLQFEFLARAGMLHHRIPELAAY 430
            ....:....:..|..|||      |.|    .:|.|                             
  Rat   178 TYNVSDPRRFHCLTMGGS------DTS----QVPNG----------------------------- 203

  Fly   431 PHHAILGKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWK 495
                     :|.||||||.||||||::|..|.||||.:|.|:|:.|.|||.||||||||||:|.|
  Rat   204 ---------KRMRTAFTSTQLLELEREFSSNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHK 259

  Fly   496 RSKKAQQEAKER------AKANQQQQQQQQTPSAAS 525
            :..|........      ::|:..:.:.:.:.|.||
  Rat   260 KEGKGASRNNHASCKCVGSQAHYARSEDEDSLSPAS 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 36/52 (69%)
Gsx2NP_001131035.2 Homeobox 207..260 CDD:395001 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.