DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and Meox1

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001102307.1 Gene:Meox1 / 363684 RGDID:1308911 Length:253 Species:Rattus norvegicus


Alignment Length:260 Identity:81/260 - (31%)
Similarity:110/260 - (42%) Gaps:67/260 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 SPSPDGMSRS------ESPTSSHRSS--------PPISPGCEDQQQPHGALHPQHLSMRMSDFHD 349
            :|..:|.|.|      .:|.|.|:.|        |..|..|.       |..|..|......|::
  Rat    24 NPHSEGSSASGLPHYPPTPFSFHQKSDFPATAAYPDFSTSCL-------AATPHSLPRAERIFNE 81

  Fly   350 EFKKPIPPHSPIRPQDFPLYAGGHPYQLLAQGGSAFHRPLDPSGKPIPIP----MGHNFMPSQLQ 410
            :  .|..|.:|  ...||:...|.... |...|||  |.:. :|.|..:.    :|.:.|.    
  Rat    82 Q--HPAFPQTP--DWHFPISEAGQRLN-LGPAGSA--REMG-AGSPGLVDGTGGLGEDCMV---- 134

  Fly   411 FEFLARAGMLHH--------RIPELAAYPHHAILG-------KTRRPRTAFTSQQLLELEKQFKQ 460
                  .|.:.|        |..|.:..|.:.  |       |.|:.|||||.:||.|||.:|..
  Rat   135 ------LGTIAHETEKKLSRRKKERSDNPENG--GGKPEGSSKARKERTAFTKEQLRELEAEFAH 191

  Fly   461 NKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKKAQQEAKERAKANQQQQQQQQTPSAAS 525
            :.||:|.:|:|:|..|.|||.|||:|||||||||||.|..|       ..:.|:|..:...||||
  Rat   192 HNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQ-------PVSPQEQDPEDGDSAAS 249

  Fly   526  525
              Rat   250  249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 32/52 (62%)
Meox1NP_001102307.1 COG5576 139..251 CDD:227863 50/120 (42%)
Homeobox 174..227 CDD:395001 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.