DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and pnx

DIOPT Version :10

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_840087.1 Gene:pnx / 352939 ZFINID:ZDB-GENE-030328-42 Length:182 Species:Danio rerio


Alignment Length:59 Identity:36/59 - (61%)
Similarity:44/59 - (74%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   438 KTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKR 496
            |::|.|||||..||..||:.|:.:.|||..:|..:||.|.||||||||||||||.|||:
Zfish    66 KSKRIRTAFTLDQLRILERSFQSSHYLSVFERHCIASALGLSETQVKIWFQNRRTKWKK 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeodomain 440..496 CDD:459649 34/55 (62%)
pnxNP_840087.1 Important for interaction with tle3a. /evidence=ECO:0000269|PubMed:12642490 1..34
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..63
Homeodomain 68..124 CDD:459649 34/55 (62%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.