DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and HOXD8

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_062458.1 Gene:HOXD8 / 3234 HGNCID:5139 Length:290 Species:Homo sapiens


Alignment Length:306 Identity:88/306 - (28%)
Similarity:117/306 - (38%) Gaps:93/306 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 AAAAAQAAASAA--------------GG--ISEQEALQRIRDSREYDSPSPDGMSRSESPTSSHR 316
            |||||.|||..|              ||  .:...|||...:|......:|     .::....|.
Human    15 AAAAAAAAAGEAINPTYYDCHFAPEVGGRHAAAAAALQLYGNSAAGFPHAP-----PQAHAHPHP 74

  Fly   317 SSPPISPGC---EDQQQPHGALHPQHLSMRMSDFHDEFKKPIPPHSPIRPQDFPLYAGGHPYQLL 378
            |.||...||   |.:.|.:  .||...|...:   .:...|.|||.|..|...|.          
Human    75 SPPPSGTGCGGREGRGQEY--FHPGGGSPAAA---YQAAPPPPPHPPPPPPPPPC---------- 124

  Fly   379 AQGGSAFHRPLDPSGKPIPIPMGHNFMPSQLQFEFLARAGMLHHRIPELAAYPH----------- 432
              ||.|.|      |:|... .|::.:..|..|.....|        ||..||.           
Human   125 --GGIACH------GEPAKF-YGYDNLQRQPIFTTQQEA--------ELVQYPDCKSSSGNIGED 172

  Fly   433 -------------------HAILGKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLML 478
                               .|..|: ||.|..::..|.|||||:|..|.||:|.:|.||:..|.|
Human   173 PDHLNQSSSPSQMFPWMRPQAAPGR-RRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALAL 236

  Fly   479 SETQVKIWFQNRRMKWKRSKK------AQQEAKERAKANQQQQQQQ 518
            :|.||||||||||||||:...      ::||.|:.....:.|:.::
Human   237 TERQVKIWFQNRRMKWKKENNKDKFPVSRQEVKDGETKKEAQELEE 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 30/52 (58%)
HOXD8NP_062458.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 60..127 20/88 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..200 3/39 (8%)
Homeobox 201..253 CDD:278475 30/51 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..290 4/28 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.