DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and HOXD4

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_055436.2 Gene:HOXD4 / 3233 HGNCID:5138 Length:255 Species:Homo sapiens


Alignment Length:221 Identity:67/221 - (30%)
Similarity:95/221 - (42%) Gaps:62/221 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 PISPGCEDQQQPHGALHPQHLSMRMSDFHD------EFKKP-IPPHSPIRPQDF---------PL 368
            |..|.||:.      |...:|..:.:|::.      :|:.| :.|......|.|         .|
Human    15 PKFPPCEEY------LQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQPFGGSGPGPGSAL 73

  Fly   369 YAGGHPYQLLAQGGSAFHR-------PLDPSGKPIPIPMGHNFMPSQLQFEFLARAGMLHHRIPE 426
            .|.||..:   .||...|.       |..|:..|.|:|....:..|..:            :.|.
Human    74 PARGHGQE---PGGPGGHYAAPGEPCPAPPAPPPAPLPGARAYSQSDPK------------QPPS 123

  Fly   427 LAAYPHHAIL------------------GKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVA 473
            ..|....|::                  |:.:|.|||:|.||:|||||:|..|:||:|.:|.|:|
Human   124 GTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIA 188

  Fly   474 SGLMLSETQVKIWFQNRRMKWKRSKK 499
            ..|.|||.|:||||||||||||:..|
Human   189 HTLCLSERQIKIWFQNRRMKWKKDHK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 34/52 (65%)
HOXD4NP_055436.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..127 20/110 (18%)
Antp-type hexapeptide 133..138 0/4 (0%)
Homeobox 157..210 CDD:306543 34/52 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..255 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.