DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and HOXD3

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_008829.3 Gene:HOXD3 / 3232 HGNCID:5137 Length:432 Species:Homo sapiens


Alignment Length:187 Identity:62/187 - (33%)
Similarity:83/187 - (44%) Gaps:46/187 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 PGCEDQQQPHGALHPQHLSMRMSDFHDEFKKPIPPHSPIRPQDFPLYAGGHPYQLLAQGGSAFHR 387
            ||...:|||     ||.                ||..|..|...|...||.......:||     
Human   108 PGLNSEQQP-----PQP----------------PPPPPTLPPSSPTNPGGGVPAKKPKGG----- 146

  Fly   388 PLDPSGKPIPIPMGHNFMP-------SQLQFEFLARAG-MLHHRIPELAAYPHHAILGKTRRPRT 444
               |:.......:.....|       :..|....|.|| ....:.|...|         ::|.||
Human   147 ---PNASSSSATISKQIFPWMKESRQNSKQKNSCATAGESCEDKSPPGPA---------SKRVRT 199

  Fly   445 AFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKKAQ 501
            |:||.||:||||:|..|:||.||:|.|:|:.|.|:|.|:||||||||||:|:.:||:
Human   200 AYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKAK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 34/52 (65%)
HOXD3NP_008829.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..62
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..197 24/126 (19%)
Antp-type hexapeptide 160..165 1/4 (25%)
Homeobox 198..250 CDD:306543 34/51 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 253..280 2/4 (50%)
DUF4074 369..430 CDD:315871
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..432
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.