DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and HOXB8

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_076921.1 Gene:HOXB8 / 3218 HGNCID:5119 Length:243 Species:Homo sapiens


Alignment Length:201 Identity:61/201 - (30%)
Similarity:85/201 - (42%) Gaps:58/201 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 AGG---HPYQLLAQGGSAFHRPLDPSGKPI---PIPMGHNFMPSQLQ-FEFLARAGMLHHRIPEL 427
            :||   ||.|:    ...:|.|...|..|.   |..:..:..|.... ::.|.|..:...:.|:|
Human    44 SGGSFQHPSQI----QEFYHGPSSLSTAPYQQNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPDL 104

  Fly   428 AAYPH-------------------------------HAILGKTRRPRTAFTSQQLLELEKQFKQN 461
            ..|..                               .|..|: ||.|..::..|.|||||:|..|
Human   105 VQYADCKLAAASGLGEEAEGSEQSPSPTQLFPWMRPQAAAGR-RRGRQTYSRYQTLELEKEFLFN 168

  Fly   462 KYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKR--------SKKAQQEAKERAKANQQQQQQQ 518
            .||:|.:|.||:..|.|:|.||||||||||||||:        |.|.:||..|:       |:.:
Human   169 PYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEK-------QKLE 226

  Fly   519 QTPSAA 524
            :.|.||
Human   227 RAPEAA 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 30/52 (58%)
HOXB8NP_076921.1 Antp-type hexapeptide 134..139 0/4 (0%)
Homeobox 150..203 CDD:395001 31/52 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..243 9/37 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.