DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and HOXB4

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_076920.1 Gene:HOXB4 / 3214 HGNCID:5115 Length:251 Species:Homo sapiens


Alignment Length:464 Identity:105/464 - (22%)
Similarity:129/464 - (27%) Gaps:273/464 - (58%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PPAQDYDQGSNQSTLSPRSQITPSPPAASPTHSAATTGSPVSTYTPALSPGG--AQDSSQTESGQ 112
            ||.::|.|          |...|                  |.::|....||  .:.|.|.|:|.
Human    18 PPCEEYSQ----------SDYLP------------------SDHSPGYYAGGQRRESSFQPEAGF 54

  Fly   113 SSQMPLLV----APMPVGTGPPHSHPPPPHPRLYVEGFPPPHHVPHPHPALGTYPLPRLPLMLPA 173
            ..:....|    |....|..||   ||||.|       |||                        
Human    55 GRRAACTVQRYAACRDPGPPPP---PPPPPP-------PPP------------------------ 85

  Fly   174 NPPGVPSGAAAPPPVSPQPAANHLSHSGATMATTTLLP-PAQSQPKKSFCIDALLAKSQHQSGEP 237
             |||:...|.||||            :||      ||| |.|                       
Human    86 -PPGLSPRAPAPPP------------AGA------LLPEPGQ----------------------- 108

  Fly   238 QPIIVDDRLAALHYARDQAELNHAFVTASNAAAAAQAAASAAGGISEQEALQRIRDSREYDSPSP 302
                                                                             
Human   109 ----------------------------------------------------------------- 108

  Fly   303 DGMSRSESPTSSHRSSPPISPGCEDQQQPHGALHPQHLSMRMSDFHDEFKKPI------PPH-SP 360
                |.|:.:    |||| .|.|  .|.|   |||       |..|...|:|:      ..| |.
Human   109 ----RCEAVS----SSPP-PPPC--AQNP---LHP-------SPSHSACKEPVVYPWMRKVHVST 152

  Fly   361 IRPQDFPLYAGGHPYQLLAQGGSAFHRPLDPSGKPIPIPMGHNFMPSQLQFEFLARAGMLHHRIP 425
            :.|.    ||||.|                                                   
Human   153 VNPN----YAGGEP--------------------------------------------------- 162

  Fly   426 ELAAYPHHAILGKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNR 490
                          :|.|||:|.||:|||||:|..|:||:|.:|.|:|..|.|||.|:|||||||
Human   163 --------------KRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHALCLSERQIKIWFQNR 213

  Fly   491 RMKWKRSKK 499
            |||||:..|
Human   214 RMKWKKDHK 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 34/52 (65%)
HOXB4NP_076920.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..134 56/305 (18%)
Antp-type hexapeptide 141..146 0/4 (0%)
Homeobox 165..218 CDD:278475 34/52 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 220..251 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.