DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and HOXB1

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_002135.2 Gene:HOXB1 / 3211 HGNCID:5111 Length:301 Species:Homo sapiens


Alignment Length:360 Identity:93/360 - (25%)
Similarity:131/360 - (36%) Gaps:104/360 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 PAANHLSHSGATMATTTLLPPAQSQPKKSFCIDALLAKSQHQSGEPQPIIVDDRLAALHYARDQA 256
            |..|....:.:..:..|..||:.:|     .:|:..::.::..|...|                 
Human    13 PLCNRGPSAYSAHSAPTSFPPSSAQ-----AVDSYASEGRYGGGLSSP----------------- 55

  Fly   257 ELNHAFVTASNAAAAAQAAASAAGGISEQEALQRIRDSREYDSPSPDGMSRSESPTSSHRSSPPI 321
                ||  ..|:...||...|..|                  .|.|.......:|.:   .||..
Human    56 ----AF--QQNSGYPAQQPPSTLG------------------VPFPSSAPSGYAPAA---CSPSY 93

  Fly   322 SPGCEDQQQP-------HGALHPQHLSMRMSDFHDEF------KKPIPP-HSPIRPQD----FPL 368
            .|   .|..|       .|..||.....::....|.:      ..|.|| |.|...:.    .|.
Human    94 GP---SQYYPLGQSEGDGGYFHPSSYGAQLGGLSDGYGAGGAGPGPYPPQHPPYGNEQTASFAPA 155

  Fly   369 YAGGHPYQLLAQGGSAFHRPLDPSGKPIPIPMGHNFMPSQLQFEFLARAGMLHHRIPELAAYPHH 433
            ||     .||::            .|..|.|...| .|:...|::     |...|.|...|....
Human   156 YA-----DLLSE------------DKETPCPSEPN-TPTARTFDW-----MKVKRNPPKTAKVSE 197

  Fly   434 AILGKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSK 498
            ..||.....||.||::||.||||:|..||||||.:|.|:|:.|.|:||||||||||||||.|  |
Human   198 PGLGSPSGLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQK--K 260

  Fly   499 KAQQEAK---------ERAKANQQQQQQQQTPSAA 524
            :.::|.:         :.|..:...|....:|.|:
Human   261 REREEGRVPPAPPGCPKEAAGDASDQSTCTSPEAS 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 36/52 (69%)
HOXB1NP_002135.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..77 15/102 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..149 5/21 (24%)
Antp-type hexapeptide 179..184 1/9 (11%)
Homeobox 207..259 CDD:278475 36/51 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..301 11/44 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.