DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and HOXA7

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_008827.2 Gene:HOXA7 / 3204 HGNCID:5108 Length:230 Species:Homo sapiens


Alignment Length:115 Identity:50/115 - (43%)
Similarity:61/115 - (53%) Gaps:19/115 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   418 GMLH------HRIPELAAYPHHAILGKTR-RPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASG 475
            |.||      .||     ||.....|..| |.|..:|..|.|||||:|..|:||:|.:|.|:|..
Human   107 GALHGAAEANFRI-----YPWMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHA 166

  Fly   476 LMLSETQVKIWFQNRRMKWKRSKKAQQEAKERAKANQQQQQQQQTPSAAS 525
            |.|:|.|:||||||||||||:..|  .|....|.|     .:...||||:
Human   167 LCLTERQIKIWFQNRRMKWKKEHK--DEGPTAAAA-----PEGAVPSAAA 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 30/52 (58%)
HOXA7NP_008827.2 Antp-type hexapeptide 119..124 3/9 (33%)
Homeobox 134..186 CDD:278475 30/51 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..230 8/30 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.