DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and HOXA6

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_076919.1 Gene:HOXA6 / 3203 HGNCID:5107 Length:233 Species:Homo sapiens


Alignment Length:245 Identity:75/245 - (30%)
Similarity:98/245 - (40%) Gaps:88/245 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 MSDFHDEFKKPIPPHSPIRPQD-----FPLYAGGHP------------------------YQ--- 376
            ||.:   |..|..|.|....||     .|||..|:.                        ||   
Human     1 MSSY---FVNPTFPGSLPSGQDSFLGQLPLYQAGYDALRPFPASYGASSLPDKTYTSPCFYQQSN 62

  Fly   377 -LLA-------QGGSAFHRPLDPSGKPIPIPMGH----------NFMPSQLQFEFLARAGM---L 420
             :||       .|.|.|:...|.||..   |.|.          :|.|.| |::..:.:|.   |
Human    63 SVLACNRASYEYGASCFYSDKDLSGAS---PSGSGKQRGPGDYLHFSPEQ-QYKPDSSSGQGKAL 123

  Fly   421 HHR----------IPEL--------AAYPHHAILGKTRRPRTAFTSQQLLELEKQFKQNKYLSRP 467
            |..          .|.:        |.|..|.     ||.|..:|..|.|||||:|..|:||:|.
Human   124 HDEGADRKYTSPVYPWMQRMNSCAGAVYGSHG-----RRGRQTYTRYQTLELEKEFHFNRYLTRR 183

  Fly   468 KRFEVASGLMLSETQVKIWFQNRRMKWKRSKK---AQQEAKE--RAKANQ 512
            :|.|:|:.|.|:|.|:||||||||||||:..|   :.|.:.|  .|||.:
Human   184 RRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQPSGEDSEAKAGE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 30/52 (58%)
HOXA6NP_076919.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..127 9/41 (22%)
Antp-type hexapeptide 136..141 1/4 (25%)
Homeobox 159..212 CDD:365835 31/52 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..233 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.