DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and HOXA5

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_061975.2 Gene:HOXA5 / 3202 HGNCID:5106 Length:270 Species:Homo sapiens


Alignment Length:304 Identity:78/304 - (25%)
Similarity:105/304 - (34%) Gaps:120/304 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 SHSGATMATTTLLPPAQSQPKKSFCIDALLAKSQHQSGEPQPIIVDDRLAALHYARDQAELNHAF 262
            :.|.|..|:.....|..|||          |.|.|   .|||    |.|.....|......:|. 
Human    70 ARSYAASASAAPAEPRYSQP----------ATSTH---SPQP----DPLPCSAVAPSPGSDSHH- 116

  Fly   263 VTASNAAAAAQAAASAAGG--ISEQEALQRIRDSREYDSPSPDGMSRSESPTSSHRSSPPISPGC 325
             ...|:.:.:..|::.||.  ||.:|.:.....:.|            ::|.||.::|....|. 
Human   117 -GGKNSLSNSSGASADAGSTHISSREGVGTASGAEE------------DAPASSEQASAQSEPS- 167

  Fly   326 EDQQQPHGALHPQHLSMRMSDFHDEFKKPIPPHSPIRPQDFPLYAGGHPYQLLAQGGSAFHRPLD 390
                                           |..|.:||.:|                 :.|.|.
Human   168 -------------------------------PAPPAQPQIYP-----------------WMRKLH 184

  Fly   391 PSGKPIPIPMGHNFMPSQLQFEFLARAGMLHHRIPELAAYPHHAILGKTRRPRTAFTSQQLLELE 455
            .|...|..|.|                                      :|.|||:|..|.||||
Human   185 ISHDNIGGPEG--------------------------------------KRARTAYTRYQTLELE 211

  Fly   456 KQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKK 499
            |:|..|:||:|.:|.|:|..|.|||.|:||||||||||||:..|
Human   212 KEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 33/52 (63%)
HOXA5NP_061975.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..175 30/162 (19%)
Antp-type hexapeptide 176..181 1/21 (5%)
Homeobox 199..251 CDD:306543 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.