DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and HOXA4

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_002132.3 Gene:HOXA4 / 3201 HGNCID:5105 Length:320 Species:Homo sapiens


Alignment Length:403 Identity:108/403 - (26%)
Similarity:138/403 - (34%) Gaps:135/403 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 YVEGFPPPHHVPHPHPALGTYPLPRLPLMLPANPPGVPSGAAAPPPVSPQPAANHLSHSGATMAT 206
            |:|...||......|...|                |...|....|.....||             
Human    12 YIEPKFPPFEEYAQHSGSG----------------GADGGPGGGPGYQQPPA------------- 47

  Fly   207 TTLLPPAQSQPKKSFCIDALLAKSQ--HQSGEPQPIIVDDRLAALHYARDQAELNHAFVTASNAA 269
                ||.|..|         |.:.|  |..|..:|       .|.:||..         ||...|
Human    48 ----PPTQHLP---------LQQPQLPHAGGGREP-------TASYYAPR---------TAREPA 83

  Fly   270 AAAQAAASAAGGISEQEALQRIRDSREYDSPSPDGMSRSESPTSSHRSSPPISPGCEDQQQPHGA 334
            ..|.|...|.|..               |:..|.|.....||   .|...|..|..:.:...|| 
Human    84 YPAAALYPAHGAA---------------DTAYPYGYRGGASP---GRPPQPEQPPAQAKGPAHG- 129

  Fly   335 LHPQHLSMRMSDFHDEFKKP-----IPPHSPIRPQDFPLYAGGHPYQLLAQGGSAFHRPLDPSGK 394
            ||..|:      ...:...|     :||.:|.|.:..|...|      :..||||...||     
Human   130 LHASHV------LQPQLPPPLQPRAVPPAAPRRCEAAPATPG------VPAGGSAPACPL----- 177

  Fly   395 PIPIPMGHNFMPSQLQFEFLARAGMLHHRIPELAAYP-----HHAIL------GKTRRPRTAFTS 448
                              .||....|..:..|...||     |.:.:      |:.:|.|||:|.
Human   178 ------------------LLADKSPLGLKGKEPVVYPWMKKIHVSAVNPSYNGGEPKRSRTAYTR 224

  Fly   449 QQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKR-----SKKAQQEAKERA 508
            ||:|||||:|..|:||:|.:|.|:|..|.|||.||||||||||||||:     :.|.:......|
Human   225 QQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKLPNTKMRSSNSASA 289

  Fly   509 KANQQQQQQQQTP 521
            .|....:.|.|:|
Human   290 SAGPPGKAQTQSP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 35/52 (67%)
HOXA4NP_002132.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..77 20/106 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..168 19/82 (23%)
Antp-type hexapeptide 194..199 2/4 (50%)
Homeobox 218..271 CDD:278475 35/52 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..320 6/30 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.