DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and HOXA3

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001371264.1 Gene:HOXA3 / 3200 HGNCID:5104 Length:443 Species:Homo sapiens


Alignment Length:433 Identity:89/433 - (20%)
Similarity:116/433 - (26%) Gaps:221/433 - (51%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PTHSAATTGSPVSTYTPAL---SPGGAQDSSQTESGQSSQMPLLVAP--MPVGTGPPHSHPPPPH 138
            |..::|..|:....:.||.   ||..|....:......:.:..|.||  .|...|.|..||||| 
Human    32 PYPASAALGADGEYHRPACSLQSPSSAGGHPKAHELSEACLRTLSAPPSQPPSLGEPPLHPPPP- 95

  Fly   139 PRLYVEGFPPPHHVPHPHPALGTYPLPRLPLMLPANPPGVPSGAAAPPPVSPQPAANHLSHSGAT 203
                 :..||....|.|.|                .|| .|:.||.|||.|..|..|        
Human    96 -----QAAPPAPQPPQPAP----------------QPP-APTPAAPPPPSSASPPQN-------- 130

  Fly   204 MATTTLLPPAQSQPKKSFCIDALLAKSQHQSGEPQPIIVDDRLAALHYARDQAELNHAFVTASNA 268
                                                                         |||.
Human   131 -------------------------------------------------------------ASNN 134

  Fly   269 AAAAQAAASAAGGISEQEALQRIRDSREYDSPSP-----DGMSRSESPTSSHRSSPPISPGCEDQ 328
            ...|.||.|..                 .:||:.     ..|..|...|....||......|...
Human   135 PTPANAAKSPL-----------------LNSPTVAKQIFPWMKESRQNTKQKTSSSSSGESCAGD 182

  Fly   329 QQPHGALHPQHLSMRMSDFHDEFKKPIPPHSPIRPQDFPLYAGGHPYQLLAQGGSAFHRPLDPSG 393
            :.|.|.                                                           
Human   183 KSPPGQ----------------------------------------------------------- 188

  Fly   394 KPIPIPMGHNFMPSQLQFEFLARAGMLHHRIPELAAYPHHAILGKTRRPRTAFTSQQLLELEKQF 458
                                                       ..::|.|||:||.||:||||:|
Human   189 -------------------------------------------ASSKRARTAYTSAQLVELEKEF 210

  Fly   459 KQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKKAQ 501
            ..|:||.||:|.|:|:.|.|:|.|:||||||||||:|:.:|.:
Human   211 HFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKGK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 34/52 (65%)
HOXA3NP_001371264.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..147 34/180 (19%)
Antp-type hexapeptide 155..160 0/4 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..196 9/138 (7%)
Homeobox 195..248 CDD:395001 34/52 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..338 2/7 (29%)
DUF4074 378..441 CDD:404218
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.