DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and Hoxc5

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001101586.1 Gene:Hoxc5 / 315341 RGDID:1307584 Length:222 Species:Rattus norvegicus


Alignment Length:245 Identity:68/245 - (27%)
Similarity:103/245 - (42%) Gaps:50/245 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 TASNAAAAAQAAAS--AAGGISEQEALQRIRDSREYDSPSPDGMSRSESPTSSHRSSPPISPGCE 326
            |..|..:|::..||  ..||:..         |..:..|:|..........::.|:.|. .|.|.
  Rat    23 TCGNYGSASEVQASRYCYGGLDL---------SITFPPPAPSNSLHGVDMAANPRAHPD-RPACS 77

  Fly   327 DQQQPHGALHPQHLSMRMSDFHDEFKKPIPPHSPIRPQDFPLYAGGHPYQLLAQGGSAFHRPLDP 391
            ....|..||.           .||       .:|:.|..:...|.....:..|:...........
  Rat    78 AAAAPGHALG-----------RDE-------AAPLNPGMYSQKAARPALEERAKSSGEIKEEQAQ 124

  Fly   392 SGKPIPIPMGHNFMPSQLQ-FEFLARAGMLHHRIPELAAYPHHAILGKTRRPRTAFTSQQLLELE 455
            :|:    |.|.:..|:..| :.::.:..|.|..              ..:|.||::|..|.||||
  Rat   125 TGQ----PAGLSQPPAPPQIYPWMTKLHMSHET--------------DGKRSRTSYTRYQTLELE 171

  Fly   456 KQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKR-SKKAQQEA 504
            |:|..|:||:|.:|.|:|:.|.|:|.|:||||||||||||: ||...:||
  Rat   172 KEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKMKSKEA 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 31/52 (60%)
Hoxc5NP_001101586.1 COG5373 65..>142 CDD:227665 18/99 (18%)
Homeobox 158..212 CDD:395001 32/53 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.