DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and hoxb8b

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_571256.1 Gene:hoxb8b / 30420 ZFINID:ZDB-GENE-980526-291 Length:247 Species:Danio rerio


Alignment Length:89 Identity:43/89 - (48%)
Similarity:55/89 - (61%) Gaps:8/89 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   440 RRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKR-------- 496
            ||.|..::..|.|||||:|..|.||:|.:|.||:..|.|:|.||||||||||||||:        
Zfish   146 RRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRMKWKKEHNKDKFP 210

  Fly   497 SKKAQQEAKERAKANQQQQQQQQT 520
            |.||:||..||.:....|..::.|
Zfish   211 SSKAEQEEIERERQEGSQVSEKHT 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 30/52 (58%)
hoxb8bNP_571256.1 Antp-type hexapeptide 134..139
Homeobox 149..201 CDD:278475 30/51 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..247 10/34 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.