DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and Hoxb3

DIOPT Version :10

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001100512.1 Gene:Hoxb3 / 303488 RGDID:1310780 Length:429 Species:Rattus norvegicus


Alignment Length:85 Identity:44/85 - (51%)
Similarity:59/85 - (69%) Gaps:3/85 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   439 TRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKKAQQE 503
            ::|.|||:||.||:||||:|..|:||.||:|.|:|:.|.|||.|:||||||||||:|:.:||:..
  Rat   187 SKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKAKGL 251

  Fly   504 AKER---AKANQQQQQQQQT 520
            |...   :.|....|..|.|
  Rat   252 ASSSGGPSPAGSPPQPMQST 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeodomain 440..496 CDD:459649 36/55 (65%)
Hoxb3NP_001100512.1 Homeodomain 188..244 CDD:459649 36/55 (65%)
DUF4074 365..427 CDD:463833
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.