DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and hoxb4a

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_571193.1 Gene:hoxb4a / 30340 ZFINID:ZDB-GENE-990415-105 Length:246 Species:Danio rerio


Alignment Length:236 Identity:71/236 - (30%)
Similarity:100/236 - (42%) Gaps:46/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 PISPGCEDQQQ-----PHGALHPQHLSMRMSD--------FHDEFKKPIPPHSPIRPQDFPLYAG 371
            |..|.||:..|     .|.   |.:.|.:..|        :|.......||:|..:       ..
Zfish    15 PKFPPCEEYSQSDYLPSHS---PDYYSAQRQDPSFQHESIYHQRSGCADPPYSSCQ-------GP 69

  Fly   372 GHPYQLLAQGGSAFHRPLDPSGKPIPIPMGH--NFMPSQL----QFEFLARAGMLHHRIPELAAY 430
            |.|..:::..|...  |......|:|.|..|  :..||..    |.........:..| .:...|
Zfish    70 GQPAAVISPRGHVL--PTTALSTPLPEPSHHCDSVTPSPPPACGQTPTSQNTSTVSSR-KDPVVY 131

  Fly   431 P-----HHAIL------GKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVK 484
            |     |..|:      |:.:|.|||:|.||:|||||:|..|:||:|.:|.|:|..|.|||.|:|
Zfish   132 PWMKKVHVNIVSPNYSGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHTLCLSERQIK 196

  Fly   485 IWFQNRRMKWKRSKKAQQEAKERAKANQQQQQQQQTPSAAS 525
            |||||||||||:..|.   ...:.::|.........|:..|
Zfish   197 IWFQNRRMKWKKDHKL---PNTKIRSNSASTNSSGCPTLCS 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 34/52 (65%)
hoxb4aNP_571193.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..125 20/113 (18%)
Antp-type hexapeptide 130..135 2/4 (50%)
Homeobox 154..207 CDD:278475 34/52 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..246 4/28 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4759
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.