DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and hoxb3a

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_571192.2 Gene:hoxb3a / 30339 ZFINID:ZDB-GENE-990415-104 Length:417 Species:Danio rerio


Alignment Length:332 Identity:78/332 - (23%)
Similarity:117/332 - (35%) Gaps:136/332 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 SPQPAANHLSH-------SGATMATTTLLPPAQSQPKKS-----FCIDALLAKSQH---QSGEPQ 238
            :|.||..:.:|       |..::.:.....|.|.|..|:     .|:...|....|   |...||
Zfish    28 APAPAFQNSAHLEGDYQRSACSLQSLGTSAPPQPQHAKTKELNGSCMRPSLPPEHHPPPQVSPPQ 92

  Fly   239 PIIVDDRLAALHYARDQAELNHAFVTASNAAAAAQAAASAAGGISEQEALQRIRDSREYDSPSPD 303
                                |...|.|:|  |..|...|..||::                 ...
Zfish    93 --------------------NTVNVAATN--ATQQPGGSGGGGVA-----------------GSG 118

  Fly   304 GMSRSESPTSSHRSSPPIS----PGCEDQQQPHGALHPQHLSMRMSDFHDEFKKPIPPHSPIRPQ 364
            |.|:|.|.:||..::|.::    |..::.:|                 :.:.|...|..|....:
Zfish   119 GTSKSSSKSSSMATNPTLTKQIFPWMKESRQ-----------------NTKQKNSSPSASSANAE 166

  Fly   365 DFPLYAGGHPYQLLAQGGSAFHRPLDPSGKPIPIPMGHNFMPSQLQFEFLARAGMLHHRIPELAA 429
                          :.||..     .|.|.                                   
Zfish   167 --------------SSGGEK-----SPPGS----------------------------------- 177

  Fly   430 YPHHAILGKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKW 494
                   ..::|.|||:||.||:||||:|..|:||.||:|.|:|:.|.|||.|:||||||||||:
Zfish   178 -------AASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKY 235

  Fly   495 KRSKKAQ 501
            |:.:|::
Zfish   236 KKDQKSK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 35/52 (67%)
hoxb3aNP_571192.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..135 25/122 (20%)
Antp-type hexapeptide 140..145 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..184 9/114 (8%)
Homeobox 184..236 CDD:278475 35/51 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 237..290 1/6 (17%)
DUF4074 353..415 CDD:290032
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.