DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and hoxb2a

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_571191.1 Gene:hoxb2a / 30338 ZFINID:ZDB-GENE-990415-103 Length:390 Species:Danio rerio


Alignment Length:226 Identity:71/226 - (31%)
Similarity:91/226 - (40%) Gaps:65/226 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 TSSHRSSPPISPGCEDQQQPHGALHPQHLSMRMSDFHDEFKKPIPPHSP-----IRPQDFPLYAG 371
            |||.:.|..|.|                          .|:..||..||     .||:.....| 
Zfish    34 TSSIKDSTAIPP--------------------------PFEHTIPSLSPCTGNQARPRSQKRTA- 71

  Fly   372 GHPYQLLAQGGSAFHRPLDPSGKPIPI----PMGHNF--MPSQLQFEFLARAGMLHHRIPELAAY 430
            .:..||..|...    |......|.|:    |:.|.|  |..:...:...:.|.   .....||.
Zfish    72 SNGLQLRTQTAP----PTQHQQGPAPLSGGAPLAHEFPWMKEKKSSKKCPKPGA---TAAAAAAS 129

  Fly   431 PHHAILGKT--------------------RRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASG 475
            |..|..|.|                    ||.|||:|:.|||||||:|..||||.||:|.|:|:.
Zfish   130 PSQASSGYTTAGLESPTEIQGGLDNVSGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAAL 194

  Fly   476 LMLSETQVKIWFQNRRMKWKRSKKAQQEAKE 506
            |.|:|.|||:||||||||.||.....::.:|
Zfish   195 LDLTERQVKVWFQNRRMKHKRQTTHHRDGQE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 35/52 (67%)
hoxb2aNP_571191.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..73 11/59 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..100 3/22 (14%)
Antp-type hexapeptide 103..108 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..155 7/49 (14%)
Homeobox 162..214 CDD:278475 35/51 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..338 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.