DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and hoxa2b

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_571181.1 Gene:hoxa2b / 30325 ZFINID:ZDB-GENE-990415-98 Length:363 Species:Danio rerio


Alignment Length:219 Identity:71/219 - (32%)
Similarity:93/219 - (42%) Gaps:75/219 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 SSPPI-----SPGCEDQQQPHGALHPQHLSMRMSDFHDEFKKPIPPHSPIRPQDFPLYAGGHPYQ 376
            |.||:     |...:.....|..|.|           ..|::.||..:|          |.||  
Zfish    24 SFPPVGDAFQSSSIKSSTLSHSTLIP-----------PPFEQTIPSLNP----------GSHP-- 65

  Fly   377 LLAQGGSAFHRP-LDPSGK-PIP---IPMGHNFM-------------------PSQLQFEFLARA 417
                   ...|| .:|:|. |:|   :|..:.:|                   |..|.|.     
Zfish    66 -------RHSRPKQNPNGSCPLPAASLPPEYPWMKEKKASKKNQTTSTAATTDPGPLYFS----- 118

  Fly   418 GMLHHRIPELAAYPHHAILGKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQ 482
               ....||::    ....|.|||.|||:|:.|||||||:|..||||.||:|.|:|:.|.|:|.|
Zfish   119 ---PQGSPEIS----DGGSGATRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQ 176

  Fly   483 VKIWFQNRRMKWKRSKKAQQEAKE 506
            ||:||||||||.||    |.:.||
Zfish   177 VKVWFQNRRMKHKR----QTQCKE 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 35/52 (67%)
hoxa2bNP_571181.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..132 23/131 (18%)
Antp-type hexapeptide 88..93 0/4 (0%)
Homeobox 137..189 CDD:278475 35/51 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..218 7/15 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..279
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.