DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and hoxb5a

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_571176.2 Gene:hoxb5a / 30317 ZFINID:ZDB-GENE-980526-70 Length:275 Species:Danio rerio


Alignment Length:226 Identity:68/226 - (30%)
Similarity:101/226 - (44%) Gaps:56/226 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 DSREYDSPSPDGMSRSESPTSSHRSSPPISPGCEDQQQ--PHGALHPQHLSMRMSDFHDEFKKPI 355
            :||.:.||:|:  :|...|:|...:||...| |.:.:.  |.|:..|...|...:..:       
Zfish    72 NSRVFQSPAPE--TRFRQPSSCSLASPEPLP-CSNSESLGPKGSSPPSDQSTTTAGNN------- 126

  Fly   356 PPHSPIRPQDFPLYAGGHPYQLLAQGGS-----AFHRPLDPSGKPIPIPMGHNFMP-SQLQFEFL 414
                        |.:..|..::.....|     |.||             .:|..| :|.:.|..
Zfish   127 ------------LNSNTHFTEIDEASASSETEEASHR-------------ANNSAPRTQQKQETT 166

  Fly   415 A---RAGMLHHRIPELAAYP-------HHAILGKT-RRPRTAFTSQQLLELEKQFKQNKYLSRPK 468
            |   .:.....:.|::  :|       .|.:.|.. :|.|||:|..|.|||||:|..|:||:|.:
Zfish   167 ATSTTSATSDGQAPQI--FPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRR 229

  Fly   469 RFEVASGLMLSETQVKIWFQNRRMKWKRSKK 499
            |.|:|..|.|||.|:||||||||||||:..|
Zfish   230 RIEIAHALCLSERQIKIWFQNRRMKWKKDNK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 33/52 (63%)
hoxb5aNP_571176.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..181 27/143 (19%)
Antp-type hexapeptide 182..187 1/6 (17%)
Homeobox 204..256 CDD:278475 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.