DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and Meox2

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_058845.2 Gene:Meox2 / 29279 RGDID:3079 Length:303 Species:Rattus norvegicus


Alignment Length:239 Identity:73/239 - (30%)
Similarity:102/239 - (42%) Gaps:33/239 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 PSPDGMSRSESPTSSHRSSPPISPGCEDQQQPHGALHPQ-HLSMRMSDFHDEFKKPIPP----HS 359
            |:.:||..|:.....|....  ......|||.|.||... ||....|          ||    ||
  Rat    54 PNEEGMFASQHHRGHHHHHH--HHHHHHQQQQHQALQSNWHLPQMSS----------PPSAARHS 106

  Fly   360 PIRPQDFPLYAGGHPY-----QLLAQGGSAFHRPLDPSGKPIPIPMGHNFM-PSQLQFEFLARAG 418
            .....|    :||.|.     .:|....|:............|...|...: |::::    .|:|
  Rat   107 LCLQPD----SGGPPELGSSPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPAEVE----KRSG 163

  Fly   419 MLHHRIPELAAYPHH--AILGKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSET 481
            .........:...::  .:..|.|:.|||||.:|:.|||.:|..:.||:|.:|:|:|..|.|:|.
  Rat   164 SKRKSDSSDSQEGNYKSEVNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTER 228

  Fly   482 QVKIWFQNRRMKWKRSKKAQQEAKERAKANQQQQQQQQTPSAAS 525
            |||:|||||||||||.|..||.|..|.|.....::....||..|
  Rat   229 QVKVWFQNRRMKWKRVKGGQQGAAAREKELVNVKKGTLLPSELS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 30/52 (58%)
Meox2NP_058845.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..191 27/147 (18%)
Homeobox 190..243 CDD:395001 31/52 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 279..303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.