DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and Hoxd4

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001099355.1 Gene:Hoxd4 / 288153 RGDID:1309690 Length:251 Species:Rattus norvegicus


Alignment Length:233 Identity:75/233 - (32%)
Similarity:108/233 - (46%) Gaps:43/233 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 PISPGCEDQQQPHGALHPQHLSMRMSDFH------DEFKKPIPPHSPIRPQDF---PLYAGGHP- 374
            |..|.||:.      |...:|..:.:|::      .:|:   ||....|| ||   | :.||.| 
  Rat    15 PKFPPCEEY------LQGGYLGEQGADYYGSGAQGSDFQ---PPGLYPRP-DFGEQP-FGGGGPG 68

  Fly   375 --YQLLAQG--------GSAFHRPLDPSGKPIPIPM----------GHNFMPSQLQFEFLARAGM 419
              ..|.|:|        ||.:..|.:|...|.|.|:          |....|.....:..|....
  Rat    69 PGSALPARGHGQEPSGPGSHYSAPGEPCPAPPPAPLPGARACSQPTGPKQPPPGTALKQPAVVYP 133

  Fly   420 LHHRIPELAAYPHHAILGKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVK 484
            ...::...:..|::. .|:.:|.|||:|.||:|||||:|..|:||:|.:|.|:|..|.|||.|:|
  Rat   134 WMKKVHVNSVNPNYT-GGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIK 197

  Fly   485 IWFQNRRMKWKRSKKAQQEAKERAKANQQQQQQQQTPS 522
            |||||||||||:..|. ...|.|:.::.........||
  Rat   198 IWFQNRRMKWKKDHKL-PNTKGRSSSSSSSCSSSAAPS 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 34/52 (65%)
Hoxd4NP_001099355.1 Homeobox 155..209 CDD:395001 35/53 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4665
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.