DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and ind

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster


Alignment Length:375 Identity:99/375 - (26%)
Similarity:138/375 - (36%) Gaps:118/375 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 NPPGVPSGAAAPPPVSPQPAANHLSHSGATMATTTLLPPAQSQPKKSFCIDALLAKSQHQSGEPQ 238
            :|.|.|:.|||                   :|...:||.....|..:..:.:.|.....|..:.|
  Fly    26 SPGGSPTAAAA-------------------VAAAAMLPSIPMLPYPASYVGSYLFSLGIQQQQQQ 71

  Fly   239 PIIVDDRLAALHYARDQAELNHAFVTASNAAAAAQAAASAAGGISEQEALQRIRDSREYDSPSPD 303
                           .|.:..|       |||||.|||:||       |||:    ..:.|.||.
  Fly    72 ---------------QQQQQQH-------AAAAAAAAAAAA-------ALQQ----HPHVSSSPG 103

  Fly   304 GM----------SRSESPTSSHRS---SPPISPGCEDQQQPHGALHPQHLSMRMSDFHDEFKKPI 355
            .:          .|..|..|::..   |||:|.....||.|              ..|:.:..|:
  Fly   104 SLYHPYAQLFASKRKSSGFSNYEGCYPSPPLSANPNSQQLP--------------PIHNLYGSPV 154

  Fly   356 PPHSPIRPQDFPLYAGGHPYQLLAQGGSAFHRPLDPSGKPIPIPMGHNF-MPSQLQFEFLARAGM 419
                          .||.|   |.:.||....|...|...:...  :|| .|...:|:..:... 
  Fly   155 --------------VGGLP---LPEPGSFCTSPSASSSASLDYT--NNFDEPQGKRFKHESSCS- 199

  Fly   420 LHHRIPELAAYPHHAILG-------------KTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFE 471
                 |..:...:|:..|             .::|.||||||.||||||::|..|.||||.:|.|
  Fly   200 -----PNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIE 259

  Fly   472 VASGLMLSETQVKIWFQNRRMKWKRSKKAQQEAKERAKANQQQQQQQQTP 521
            :|:.|.|||.||||||||||:|.|:.............:|...|....:|
  Fly   260 IANRLRLSEKQVKIWFQNRRVKQKKGGSESPTFNLSTNSNGSPQASPVSP 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 36/52 (69%)
indNP_996087.2 Homeobox 231..283 CDD:278475 36/51 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.