DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and GSX1

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_663632.1 Gene:GSX1 / 219409 HGNCID:20374 Length:264 Species:Homo sapiens


Alignment Length:275 Identity:84/275 - (30%)
Similarity:116/275 - (42%) Gaps:74/275 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 IRDSREYDSPSPDGMSRSESPTSSHRSSPP-----ISPG-CEDQQQPHGALHPQHLSMRMSDFHD 349
            :|::.|  ..:|:|   |..|...:...||     :||| |..::.  |.|....|.:..|..|.
Human    12 LREAGE--KKAPEG---SPPPLFPYAVPPPHALHGLSPGACHARKA--GLLCVCPLCVTASQLHG 69

  Fly   350 EFKKPIPPHSPIRPQDFPLYAGGHPYQLLAQGGSAFHRPLDPSGKPIPIPMGHNFMPSQLQFEFL 414
               .|.||..|:....||      |:     |....|.||......:...:.|.  |:.     .
Human    70 ---PPGPPALPLLKASFP------PF-----GSQYCHAPLGRQHSAVSPGVAHG--PAA-----A 113

  Fly   415 ARAGMLHHRIPELAAYP------HHAI--------LGKTRRPRTAFTSQQLLELEKQFKQNKYLS 465
            |.|..|:.     .:||      .|.|        |..::|.||||||.||||||::|..|.|||
Human   114 AAAAALYQ-----TSYPLPDPRQFHCISVDSSSNQLPSSKRMRTAFTSTQLLELEREFASNMYLS 173

  Fly   466 RPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKK-----------------AQQEAK----ERAK 509
            |.:|.|:|:.|.|||.||||||||||:|.|:..|                 |.|..|    ..||
Human   174 RLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGSNHRGGGGGGAGGGGSAPQGCKCASLSSAK 238

  Fly   510 ANQQQQQQQQTPSAA 524
            .::...:...:||::
Human   239 CSEDDDELPMSPSSS 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 36/52 (69%)
GSX1NP_663632.1 SNAG domain. /evidence=ECO:0000250 1..20 2/9 (22%)
Homeobox 151..204 CDD:395001 36/52 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..264 10/53 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.