DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and Pdx1

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_032840.1 Gene:Pdx1 / 18609 MGIID:102851 Length:284 Species:Mus musculus


Alignment Length:266 Identity:83/266 - (31%)
Similarity:112/266 - (42%) Gaps:78/266 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 SEQE---ALQRIRDSREYD-SPSPDGMSRSESPTSSHRSSPPISPGCEDQQQPHGALHPQHLSMR 343
            ||::   |.|..:|...:. .|.|:..:...:.....|..||..|             ||..|..
Mouse     3 SEEQYYAATQLYKDPCAFQRGPVPEFSANPPACLYMGRQPPPPPP-------------PQFTSSL 54

  Fly   344 MSDFHDEFKKPIPPHSPIRPQDFPLYAGGHP------YQLLAQGGSAFHRPLDPSGKPIPIPMGH 402
            .|     .::..||  .|.|.:.|..|...|      :.|.||.|.| |.|      |.|.|.|.
Mouse    55 GS-----LEQGSPP--DISPYEVPPLASDDPAGAHLHHHLPAQLGLA-HPP------PGPFPNGT 105

  Fly   403 N----FMPSQLQFEFLARAGMLHHRIPELAAYPHHAILG------------KTRRPRTAFTSQQL 451
            .    ..|:::|..|           |.:.:...||..|            :.:|.|||:|..||
Mouse   106 EPGGLEEPNRVQLPF-----------PWMKSTKAHAWKGQWAGGAYTAEPEENKRTRTAYTRAQL 159

  Fly   452 LELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKKAQQEAKERAKANQQQQQ 516
            |||||:|..|||:|||:|.|:|..|.|:|..:||||||||||||:     :|.|:|:..      
Mouse   160 LELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKK-----EEDKKRSSG------ 213

  Fly   517 QQQTPS 522
               |||
Mouse   214 ---TPS 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 34/52 (65%)
Pdx1NP_032840.1 Transactivation domain. /evidence=ECO:0000250 13..73 16/79 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..116 27/112 (24%)
Antp-type hexapeptide 119..124 2/15 (13%)
Homeobox 150..203 CDD:278475 34/52 (65%)
Nuclear localization signal 198..204 5/5 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..284 8/29 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.