DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and ceh-13

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans


Alignment Length:167 Identity:55/167 - (32%)
Similarity:75/167 - (44%) Gaps:25/167 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 PPHS------------PIRPQDF-PLYAGGHPYQLLA-------QGGSAFHRPLDPSGKPIPIPM 400
            |||:            |..|..: ||  ..||..:.|       .|......|...||...|...
 Worm    10 PPHNYYQDWPTTHSYYPSVPSSYSPL--NHHPADIWAAHPSNYIMGNGHVSPPATASGLSPPASR 72

  Fly   401 GHNF---MPSQLQFEFLARAGMLHHRIPELAAYPHHAILGKTRRPRTAFTSQQLLELEKQFKQNK 462
            ..|.   :|:.:..........:|.:..:..|.|...::.:....||.||:.||.||||:|...|
 Worm    73 SSNSSAELPTGVTASQHNTYKWMHTKRSQRPAAPKKKVIDENGTNRTNFTTHQLTELEKEFHTAK 137

  Fly   463 YLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKK 499
            |::|.:|.|:||.|.|.|.||||||||||||.|:.:|
 Worm   138 YVNRTRRTEIASNLKLQEAQVKIWFQNRRMKEKKREK 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 33/52 (63%)
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 27/45 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.