DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and GSX2

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_573574.2 Gene:GSX2 / 170825 HGNCID:24959 Length:304 Species:Homo sapiens


Alignment Length:386 Identity:97/386 - (25%)
Similarity:120/386 - (31%) Gaps:169/386 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 PPHHVPHPHPA------LGTYPLPRLPLMLPANPPGVPSGAAAPPPVSPQPAANHLSHS------ 200
            |...:|.|||.      ||..|    ||::..:.||.||..:....|.|....:||..|      
Human    18 PAPSLPEPHPGPDFFIPLGMPP----PLVMSVSGPGCPSRKSGAFCVCPLCVTSHLHSSRGSVGA 78

  Fly   201 ------------------GATMATTTLLPPAQSQP-KKSFCIDALLAKSQHQSGEPQPIIVDDRL 246
                              ||..|...|.....|.| ...||  ..:..:.|....||        
Human    79 GSGGAGAGVTGAGGSGVAGAAGALPLLKGQFSSAPGDAQFC--PRVNHAHHHHHPPQ-------- 133

  Fly   247 AALHYARDQAELNHAFVTASNAAAAAQAAASAAGGISEQEALQRIRDSREYDSPSPDGMSRSESP 311
               |:.............|:.|||||.|||:|.|                               
Human   134 ---HHHHHHQPQQPGSAAAAAAAAAAAAAAAALG------------------------------- 164

  Fly   312 TSSHRSSPPISPGCEDQQQPHGALHPQHLSMRMSDFHDEFKKPIPPHSPIRPQDFPLYAGGHPYQ 376
                                    ||||                  |:|:........|....:.
Human   165 ------------------------HPQH------------------HAPVCTATTYNVADPRRFH 187

  Fly   377 LLAQGGSAFHRPLDPSGKPIPIPMGHNFMPSQLQFEFLARAGMLHHRIPELAAYPHHAILGKTRR 441
            .|..|||      |.|    .:|.|                                      :|
Human   188 CLTMGGS------DAS----QVPNG--------------------------------------KR 204

  Fly   442 PRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKKAQQ 502
            .||||||.||||||::|..|.||||.:|.|:|:.|.|||.||||||||||:|.|:..|..|
Human   205 MRTAFTSTQLLELEREFSSNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGTQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 36/52 (69%)
GSX2NP_573574.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..151 7/47 (15%)
Homeobox 206..258 CDD:306543 36/51 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..304
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.