DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and Hoxd8

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_032302.2 Gene:Hoxd8 / 15437 MGIID:96209 Length:289 Species:Mus musculus


Alignment Length:306 Identity:88/306 - (28%)
Similarity:111/306 - (36%) Gaps:102/306 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 AAAAAQAAASAAGGISEQEALQRIRDSREYD---SPSPDGMSRS--------------ESPTSSH 315
            |||||.|||:||.|    ||:    :...||   :|...|...:              ..|....
Mouse    16 AAAAAAAAAAAAAG----EAI----NPTYYDCHFAPEVSGRHAAALQLYGNSAAGFPHAHPHPHP 72

  Fly   316 RSSPPISPGC-------EDQQQPH-GALHPQHLSMRMSDFHDEFKKPIPPHSPIRPQDFPLYAGG 372
            ..|||  |||       ..|...| ||..|.....         ..|.|||.|..|...|.    
Mouse    73 HPSPP--PGCGGGGGPGPGQDYFHAGAGSPTAAYQ---------AAPPPPHPPPPPPPPPC---- 122

  Fly   373 HPYQLLAQGGSAFHRPLDPSGKPIPIPMGHNFMPSQLQFEFLARAGMLHHRIPELAAYPH----- 432
                    ||.|.|      |:|... .|::.:..|..|.....|        ||..||.     
Mouse   123 --------GGIACH------GEPAKF-YGYDNLQRQPIFTTQQEA--------ELVQYPDCKSSS 164

  Fly   433 -------------------------HAILGKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEV 472
                                     .|..|: ||.|..::..|.|||||:|..|.||:|.:|.||
Mouse   165 GNIGEDPDHLNQSSSPSQMFPWMRPQAAPGR-RRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEV 228

  Fly   473 ASGLMLSETQVKIWFQNRRMKWKRSKKAQQEAKERAKANQQQQQQQ 518
            :..|.|:|.||||||||||||||:.....:....|.:|.....:::
Mouse   229 SHTLALTERQVKIWFQNRRMKWKKENNKDKFPASRPEAKDGDPKKE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 30/52 (58%)
Hoxd8NP_032302.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 62..125 20/85 (24%)
COG5576 139..272 CDD:227863 45/141 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..184 0/21 (0%)
Antp-type hexapeptide 183..188 0/4 (0%)
Homeobox 199..251 CDD:278475 30/51 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..289 2/23 (9%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.