DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and Hoxd4

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_034599.2 Gene:Hoxd4 / 15436 MGIID:96208 Length:250 Species:Mus musculus


Alignment Length:209 Identity:71/209 - (33%)
Similarity:97/209 - (46%) Gaps:40/209 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 PISPGCEDQQQPHGALHPQHL-----SMRMSDFHDEFKKPIPPHSPIRPQDF---PLYAGGHP-- 374
            |..|.||:..| .|.|..|..     ..:.:||......|.|        ||   | :.||.|  
Mouse    15 PKFPPCEEYLQ-GGYLGEQGADYYGSGAQGADFQPSGLYPRP--------DFGEQP-FGGGGPGP 69

  Fly   375 -YQLLAQG--------GSAFHRPLD--PSGKPIPI--------PMGHNFMPSQLQFEFLARAGML 420
             ..|.|:|        ||.:..|.:  |:..|.|:        |.|....|.....:..|.....
Mouse    70 GSALPARGHGQEPSGPGSHYGAPGERCPAPPPAPLPGARACSQPTGPKQPPPGTALKQPAVVYPW 134

  Fly   421 HHRIPELAAYPHHAILGKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKI 485
            ..::...:..|::. .|:.:|.|||:|.||:|||||:|..|:||:|.:|.|:|..|.|||.|:||
Mouse   135 MKKVHVNSVNPNYT-GGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKI 198

  Fly   486 WFQNRRMKWKRSKK 499
            ||||||||||:..|
Mouse   199 WFQNRRMKWKKDHK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 34/52 (65%)
Hoxd4NP_034599.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..126 23/103 (22%)
Antp-type hexapeptide 131..136 0/4 (0%)
Homeobox 155..208 CDD:278475 34/52 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..250 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.