DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and Hoxd3

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_034598.2 Gene:Hoxd3 / 15434 MGIID:96207 Length:433 Species:Mus musculus


Alignment Length:223 Identity:70/223 - (31%)
Similarity:98/223 - (43%) Gaps:33/223 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 YDSPSPDGMSRSESPTS--SHRSSPPI---------------SPGCEDQQQPHGALHPQHLSMRM 344
            |..|:......|:.|:|  |.:||.|:               .||..:.|...|...|..|:...
Mouse    50 YPPPAAANSLDSDYPSSACSIQSSAPLRAPAHKGAELNGSCMRPGTGNSQGGGGGNQPPGLNSEQ 114

  Fly   345 SDFHDEFKKPIPPHSPIRPQDFPLYAGGHPYQLLAQGGSAFHRPLDPSGKPIPIPMGHNFMPSQL 409
            ..     .:|.||..|..|...|...|........:||.:.........|.| .|.......:..
Mouse   115 QP-----PQPPPPPPPTLPPSSPTNPGSGVPAKKTKGGLSASSSSSTISKQI-FPWMKESRQNSK 173

  Fly   410 QFEFLARAG-MLHHRIPELAAYPHHAILGKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVA 473
            |....|.:| ....:.|...|         ::|.|||:||.||:||||:|..|:||.||:|.|:|
Mouse   174 QKNSCATSGENCEDKSPPGPA---------SKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMA 229

  Fly   474 SGLMLSETQVKIWFQNRRMKWKRSKKAQ 501
            :.|.|:|.|:||||||||||:|:.:||:
Mouse   230 NLLNLTERQIKIWFQNRRMKYKKDQKAK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 34/52 (65%)
Hoxd3NP_034598.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..198 32/162 (20%)
Antp-type hexapeptide 161..166 2/5 (40%)
Homeobox 199..251 CDD:278475 34/51 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..280 70/223 (31%)
DUF4074 370..431 CDD:290032
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.