DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and Hoxb5

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_032294.2 Gene:Hoxb5 / 15413 MGIID:96186 Length:269 Species:Mus musculus


Alignment Length:252 Identity:79/252 - (31%)
Similarity:98/252 - (38%) Gaps:80/252 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 AQAAASAAGGISEQEALQRIRDSREYDSPSPDGMSRSESPTSSHRSSPPISPGCEDQQQPHGALH 336
            :.|::|..|.:.|        .||.:  |:.....|....|||...|.|.|..|.:... |||  
Mouse    59 SSASSSHFGAVGE--------SSRAF--PASAQEPRFRQATSSCSLSSPESLPCTNGDS-HGA-- 110

  Fly   337 PQHLSMRMSDFHDEFKKPIPPHSPIRPQDFPLYAGGHPYQLLAQGGSAFHRPLD---PSGKPIPI 398
                            ||    |...|.|          |......||....:|   .|.:|   
Mouse   111 ----------------KP----SASSPSD----------QATPASSSANFTEIDEASASSEP--- 142

  Fly   399 PMGHNFMPSQLQFEFLARAGMLHHRIPELAAYPHHAILGKT---------------------RRP 442
                ....|||....||||.      ||..|....|..|:|                     :|.
Mouse   143 ----EEAASQLSSPSLARAQ------PEPMATSTAAPEGQTPQIFPWMRKLHISHDMTGPDGKRA 197

  Fly   443 RTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKK 499
            |||:|..|.|||||:|..|:||:|.:|.|:|..|.|||.|:||||||||||||:..|
Mouse   198 RTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 33/52 (63%)
Hoxb5NP_032294.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..173 35/145 (24%)
Antp-type hexapeptide 176..181 0/4 (0%)
Homeobox 198..251 CDD:365835 34/52 (65%)
PRK07003 <67..>171 CDD:235906 38/159 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.