DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and Hoxa7

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_034585.1 Gene:Hoxa7 / 15404 MGIID:96179 Length:229 Species:Mus musculus


Alignment Length:176 Identity:60/176 - (34%)
Similarity:88/176 - (50%) Gaps:36/176 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 PLY----AGGHPYQLLAQGGSAFHRPLDPSGKPIPIPMGHNFMPSQLQFEFLARA--GMLHHRIP 425
            |||    |.|:     ..|..|::.|.....:.||      .:.|.|......:|  |:||.  |
Mouse    60 PLYQSPFASGY-----GLGADAYNLPCASYDQNIP------GLCSDLAKGACDKADEGVLHG--P 111

  Fly   426 ELAA---YPHHAILGKTR-RPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIW 486
            ..|:   ||.....|..| |.|..:|..|.|||||:|..|:||:|.:|.|:|..|.|:|.|:|||
Mouse   112 AEASFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIW 176

  Fly   487 FQNRRMKWKRSKKAQQEAKERA-------------KANQQQQQQQQ 519
            |||||||||:..|.:.:|...|             ||:::::::::
Mouse   177 FQNRRMKWKKEHKDESQAPTAAPEDAVPSVSTAADKADEEEEEEEE 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 30/52 (58%)
Hoxa7NP_034585.1 Antp-type hexapeptide 118..123 2/4 (50%)
Homeobox 133..185 CDD:278475 30/51 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..229 5/37 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.