DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and Hoxa1

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_034579.3 Gene:Hoxa1 / 15394 MGIID:96170 Length:336 Species:Mus musculus


Alignment Length:258 Identity:71/258 - (27%)
Similarity:113/258 - (43%) Gaps:62/258 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 SREYDSP-SPDGMSRSESPTSSHRSSPPISPGCEDQQQPHGALHPQHLSMRMSDFHDEFKKPIPP 357
            ::.:.:| .|.|:::....:..:   ||.:|          |::..:||..|...|...:.    
Mouse   102 AQNFSAPYGPYGLNQEADVSGGY---PPCAP----------AVYSGNLSTPMVQHHHHHQG---- 149

  Fly   358 HSPIRPQDFPLYAGG---------HPY----QLLAQGGSAFHRPLDP----SGKPIPIPMGHNFM 405
                       ||||         |.|    |.||.  :.::..|.|    ..:....|......
Mouse   150 -----------YAGGTVGSPQYIHHSYGQEQQTLAL--ATYNNSLSPLHASHQEACRSPASETSS 201

  Fly   406 PSQLQFEFLARAGMLHHRIPELAAYPHHAILGKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRF 470
            |:| .|:::    .:....|:......:..:|:....||.||::||.||||:|..||||:|.:|.
Mouse   202 PAQ-TFDWM----KVKRNPPKTGKVGEYGYVGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRV 261

  Fly   471 EVASGLMLSETQVKIWFQNRRMKWKRSKK--------AQQEAKERAKANQQQQQQQQTPSAAS 525
            |:|:.|.|:||||||||||||||.|:.:|        |.....:. |..:..::...:|||.|
Mouse   262 EIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATPPGSDE-KTEESSEKSSPSPSAPS 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 35/52 (67%)
Hoxa1NP_034579.3 COG5576 177..>287 CDD:227863 43/114 (38%)
Homeobox 234..287 CDD:365835 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.