DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and Gsx1

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_032204.1 Gene:Gsx1 / 14842 MGIID:95842 Length:261 Species:Mus musculus


Alignment Length:266 Identity:84/266 - (31%)
Similarity:113/266 - (42%) Gaps:71/266 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 DSPSPDGMSRSESPTSSHRSSPP-----ISPG-CEDQQQPHGALHPQHLSMRMSDFHDEFKKPIP 356
            |..:|:|   |..|...:...||     :||| |..::.  |.|....|.:..|..|.   .|.|
Mouse    17 DKKAPEG---SPPPLFPYAVPPPHALHGLSPGACHARKA--GLLCVCPLCVTASQLHG---PPGP 73

  Fly   357 PHSPIRPQDFPLYAGGHPYQLLAQGGSAFHRPLDPSGKPIPIPMGHNFMPSQLQFEFLARAGMLH 421
            |..|:....||      |:     |....|.||   |:...:..|....|:.     .|.|..|:
Mouse    74 PALPLLKASFP------PF-----GSQYCHAPL---GRQHSVSPGVAHGPAA-----AAAAAALY 119

  Fly   422 HRIPELAAYP------HHAI--------LGKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEV 472
            .     .:||      .|.|        |..::|.||||||.||||||::|..|.||||.:|.|:
Mouse   120 Q-----TSYPLPDPRQFHCISVDSSSNQLPSSKRMRTAFTSTQLLELEREFASNMYLSRLRRIEI 179

  Fly   473 ASGLMLSETQVKIWFQNRRMKWKRSKK---------------AQQEAK----ERAKANQQQQQQQ 518
            |:.|.|||.||||||||||:|.|:..|               |.|..|    ..||.::...:..
Mouse   180 ATYLNLSEKQVKIWFQNRRVKHKKEGKGSNHRGGAGAGAGGGAPQGCKCSSLSSAKCSEDDDELP 244

  Fly   519 QTPSAA 524
            .:||::
Mouse   245 MSPSSS 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 36/52 (69%)
Gsx1NP_032204.1 SNAG domain. /evidence=ECO:0000250 1..20 1/2 (50%)
Homeobox 150..203 CDD:395001 36/52 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..261 9/50 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.