DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and Hoxa3

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001300749.1 Gene:Hoxa3 / 103690130 RGDID:1561431 Length:444 Species:Rattus norvegicus


Alignment Length:439 Identity:99/439 - (22%)
Similarity:130/439 - (29%) Gaps:232/439 - (52%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PTHSAATTGSP-VSTYTPALS-----PGGAQDSS--------QTESGQSSQMPLLVAPMPVGTGP 129
            |...:||.|:. |..:.||.|     ..||...|        :|.||..||        |.|.|.
  Rat    32 PYAPSATLGTDGVEYHRPACSLQSPASAGAHPKSHELSEACLRTLSGPPSQ--------PPGLGD 88

  Fly   130 PHSHPPPPHPRLYVEGFPPPHHVPHPHPALGTYPLPRLPLMLPANPPGVPSGAAAPPP--VSPQP 192
            |...||||      :..||....|.|                |..|| .|:.||.|||  |||..
  Rat    89 PPLPPPPP------QAAPPAPQPPQP----------------PPQPP-APTPAAPPPPSSVSPPQ 130

  Fly   193 AANHLSHSGATMATTTLLPPAQSQPKKSFCIDALLAKSQHQSGEPQPIIVDDRLAALHYARDQAE 257
            :||    |..|.|:|                    |||        |:                 
  Rat   131 SAN----SNPTPAST--------------------AKS--------PL----------------- 146

  Fly   258 LNHAFVTASNAAAAAQAAASAAGGISEQEALQRIRDSREYDSPSPDGMSRSESPTSSHRSSPPIS 322
            ||...|                    .::....:::||:.......|.|..||            
  Rat   147 LNSPTV--------------------GKQIFPWMKESRQNTKQKTSGSSSGES------------ 179

  Fly   323 PGCEDQQQPHGALHPQHLSMRMSDFHDEFKKPIPPHSPIRPQDFPLYAGGHPYQLLAQGGSAFHR 387
              |...:.|.|.                                                     
  Rat   180 --CAGDKSPPGQ----------------------------------------------------- 189

  Fly   388 PLDPSGKPIPIPMGHNFMPSQLQFEFLARAGMLHHRIPELAAYPHHAILGKTRRPRTAFTSQQLL 452
                                                             ..::|.|||:||.||:
  Rat   190 -------------------------------------------------ASSKRARTAYTSAQLV 205

  Fly   453 ELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKKAQ 501
            ||||:|..|:||.||:|.|:|:.|.|:|.|:||||||||||:|:.:|.:
  Rat   206 ELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKGK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 34/52 (65%)
Hoxa3NP_001300749.1 COG5576 <182..309 CDD:227863 39/175 (22%)
Homeobox 196..249 CDD:395001 34/52 (65%)
DUF4074 379..442 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.