DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and Hoxa2

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_036713.2 Gene:Hoxa2 / 103690123 RGDID:2813 Length:372 Species:Rattus norvegicus


Alignment Length:265 Identity:79/265 - (29%)
Similarity:106/265 - (40%) Gaps:88/265 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 SSPPI-----SPGCEDQQQPHGALHPQHLSMRMSDFHDEFKKPIPPHSPIRPQDFPLYAGGHPYQ 376
            |.||:     |...:.....|..|.|           ..|::.||..:|          |.||.|
  Rat    24 SFPPVADTFQSSSIKTSTLSHSTLIP-----------PPFEQTIPSLNP----------GSHPRQ 67

  Fly   377 LLAQGGSAFHRPLDPSGKPIPI----PMGHNFMPSQLQFEFLARAGMLHHRIPELAAYPHHAILG 437
            ....||.....|....|.|:|.    |..:.:|..:...:..|        :|..||....|.||
  Rat    68 SAGAGGRPKSSPAGSRGSPVPARALQPPEYPWMKEKKAAKKTA--------LPPAAASTGPACLG 124

  Fly   438 K-------------TRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQN 489
            .             :||.|||:|:.|||||||:|..||||.||:|.|:|:.|.|:|.|||:||||
  Rat   125 HKESLEIADGSGGGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQN 189

  Fly   490 RRMKWKR-------------------SKKAQQEAKERAKANQ----------------QQQ--QQ 517
            ||||.||                   |.|.:::.:|::...|                ||.  .|
  Rat   190 RRMKHKRQTQCKENQNSEGKFKNLEDSDKVEEDEEEKSLFEQALSVSGALLEREGYTFQQNALSQ 254

  Fly   518 QQTPS 522
            ||.|:
  Rat   255 QQAPN 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 35/52 (67%)
Hoxa2NP_036713.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..96 18/74 (24%)
Antp-type hexapeptide 96..101 0/4 (0%)
Homeobox 143..196 CDD:395001 35/52 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..225 4/30 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.