DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and Hoxa4

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_077326.1 Gene:Hoxa4 / 100912525 RGDID:2814 Length:285 Species:Rattus norvegicus


Alignment Length:369 Identity:97/369 - (26%)
Similarity:120/369 - (32%) Gaps:151/369 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 YVE-GFPP-PHHVPHPHPALGTYPLPRLPLMLPANPPGVPSGAAAPPPVSPQPAANHLSHSGATM 204
            |:| .||| ....||..|..|...:        ...||.|...::|...:|.|      |  |..
  Rat    12 YIEPKFPPFEEFAPHGGPGGGDGGV--------GGGPGYPRPQSSPHLPAPNP------H--AAR 60

  Fly   205 ATTTLLPPAQSQPKKSFCIDALLAKSQHQSGEPQPIIVDDRLAALHYARDQAELNHAFVTASNAA 269
            .|.....|...:|            |.|....|.|                            ||
  Rat    61 QTPAYYAPRAREP------------SYHGGLYPAP----------------------------AA 85

  Fly   270 AAAQAAASAAGGISEQEALQRIRDSREYDSPSPDGMSRSESPTSSHRSSPPISPGCEDQQQPHGA 334
            |...|...|:....||             ||:|          .:|.|..|         ||   
  Rat    86 ACPYACRGASPARPEQ-------------SPAP----------GAHPSPAP---------QP--- 115

  Fly   335 LHPQHLSMRMSDFHDEFKKPIPPH----SPIRPQDFPLYAGGH----PYQLLAQGGSAFHRPLDP 391
                               |.||.    .|..|   .:..||.    |..|..||      |..|
  Rat   116 -------------------PAPPRRCAPGPTTP---AVATGGSAPACPLLLADQG------PAGP 152

  Fly   392 SGK-PIPIPMGHNFMPSQLQFEFLARAGMLHHRIPELAAYPHHAILGKTRRPRTAFTSQQLLELE 455
            .|| |:..|.......|.:...:..                     |:.:|.|||:|.||:||||
  Rat   153 KGKEPVVYPWMKKIHVSAVNPSYNG---------------------GEPKRSRTAYTRQQVLELE 196

  Fly   456 KQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKK 499
            |:|..|:||:|.:|.|:|..|.|||.||||||||||||||:..|
  Rat   197 KEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 35/52 (67%)
Hoxa4NP_077326.1 Homeobox 183..236 CDD:278475 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.