DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and hoxb1

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_004918719.1 Gene:hoxb1 / 100493290 XenbaseID:XB-GENE-485772 Length:304 Species:Xenopus tropicalis


Alignment Length:254 Identity:70/254 - (27%)
Similarity:97/254 - (38%) Gaps:88/254 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 YDSPSPDGMSRSESPTSSHRSSPPISPGCEDQQQPHGALHPQHLSMRMSDFHDEFKKPIPPHSPI 361
            |.||..||:...::...|:..:                        ..:.:.|.:...:|  .|.
 Frog   103 YASPDADGIYFQQTAYCSNTGA------------------------NSNSYSDGYCGAVP--GPA 141

  Fly   362 RPQDFPLYAGGHPYQLLAQGGSAFHRPLDPSGKPIPIPMGHNFMPSQLQFEFLARAGMLHHR--- 423
            :.|..|.   |..:|.|.|   |:|.|                 ||           |||..   
 Frog   142 QYQQHPY---GQEHQGLLQ---AYHNP-----------------PS-----------MLHEEKEP 172

  Fly   424 -IPELAAYPHHAI--LGKTRRP-------------------RTAFTSQQLLELEKQFKQNKYLSR 466
             .|...|.|:|..  :...|.|                   ||.||::||.||||:|..||||:|
 Frog   173 SCPSEQALPNHTFDWMKVKRNPPKTTAKPVDFGLSTQQNTIRTNFTTKQLTELEKEFHFNKYLTR 237

  Fly   467 PKRFEVASGLMLSETQVKIWFQNRRMKWKRSKK---AQQEAKERAKANQQQQQQQQTPS 522
            .:|.|:|:.|.|:||||||||||||||.|:.::   |....|...|.|.:......:.|
 Frog   238 ARRVEIAATLELNETQVKIWFQNRRMKQKKREREGLAPSAIKGSMKENGEMSDLSSSTS 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 36/71 (51%)
hoxb1XP_004918719.1 PTZ00395 <12..>147 CDD:185594 10/69 (14%)
Homeobox 214..267 CDD:365835 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.