DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and pdx1

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_002934065.1 Gene:pdx1 / 100490648 XenbaseID:XB-GENE-483331 Length:271 Species:Xenopus tropicalis


Alignment Length:241 Identity:73/241 - (30%)
Similarity:98/241 - (40%) Gaps:77/241 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 EDQQQPHGALHPQHLSMRMSDFHDEFKKPIPPHSPIRPQDFPLYAGGHPYQLLAQGGSAFHRP-- 388
            :||..|...|:.:..:.:.|...|  ..|.||..        ||.|       .|..:|:..|  
 Frog     4 DDQYYPQAPLYKEPCAFQRSQAQD--YNPSPPAC--------LYMG-------RQQQAAYSNPLV 51

  Fly   389 -LDPSGKP---------------IP---------------IPMGHNFMPSQLQFEFLARAGMLHH 422
             |||...|               :|               ||..|..||    |.....:..|..
 Frog    52 ALDPGSPPDISPYEVPPISEEPIVPHLHHHHHHHHHHHPGIPHPHQQMP----FPDDTESATLEE 112

  Fly   423 RIPELAAYP------HHAILG------------KTRRPRTAFTSQQLLELEKQFKQNKYLSRPKR 469
            |...|..:|      .|...|            :.:|.|||:|..|||||||:|..|||:|||:|
 Frog   113 RNRTLLPFPWMKSTKSHTWKGQWTGGSYIMEQEENKRTRTAYTRAQLLELEKEFLFNKYISRPRR 177

  Fly   470 FEVASGLMLSETQVKIWFQNRRMKWKRSKKAQQEAKERAKANQQQQ 515
            .|:|..|.|:|..:||||||||||||:     :|.|:|.:.:..:|
 Frog   178 VELAVMLNLTERHIKIWFQNRRMKWKK-----EEDKKRGRGSDPEQ 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 34/52 (65%)
pdx1XP_002934065.1 Homeobox 150..204 CDD:365835 35/53 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.