DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and hoxc4

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_002936684.1 Gene:hoxc4 / 100486039 XenbaseID:XB-GENE-967141 Length:297 Species:Xenopus tropicalis


Alignment Length:374 Identity:87/374 - (23%)
Similarity:124/374 - (33%) Gaps:155/374 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 YPLPRLPLML----------PANPP--------GVPSGAAAPPPVSPQPAANHLSHSGATMATTT 208
            :||.:|.:|.          |..||        .:|..:......|..||..|  |.       .
 Frog    28 FPLQKLMIMSSYLMDSNYIDPKFPPCEEYSQNNYIPEHSPEYYSRSRDPAFQH--HQ-------D 83

  Fly   209 LLPPAQSQPKKSFCIDALLAKSQHQSGEPQPIIVDDRLAALH-YARDQAELNHAFVTASNAAAAA 272
            |.||..:.|::.|...::.|     .|.|          |.| ....|.:.||..|..|...   
 Frog    84 LYPPRTAYPERQFSCASIQA-----PGNP----------ATHPRLHGQPQSNHNLVGKSQLC--- 130

  Fly   273 QAAASAAGGISEQEALQRIRDSREYDSPSPDGMSRSESPTSSHRSSPPISPGCEDQQQPHGALHP 337
                        :.....:..:....||||...:.:::|||.|       |.....:||  .::|
 Frog   131 ------------EHPTPSLASNSSSSSPSPAPTACTQAPTSEH-------PTNTASKQP--IVYP 174

  Fly   338 QHLSMRMSDFHDEFKKPIPPHSPIRPQDFPLYAGGHPYQLLAQGGSAFHRPLDPSGKPIPIPMGH 402
            ....:.:|..:                  |.|.||.|                            
 Frog   175 WMKKIHVSSVN------------------PNYTGGEP---------------------------- 193

  Fly   403 NFMPSQLQFEFLARAGMLHHRIPELAAYPHHAILGKTRRPRTAFTSQQLLELEKQFKQNKYLSRP 467
                                                 :|.|||:|.||:|||||:|..|:||:|.
 Frog   194 -------------------------------------KRSRTAYTRQQVLELEKEFHYNRYLTRR 221

  Fly   468 KRFEVASGLMLSETQVKIWFQNRRMKWKR-----SKKAQQEAKERAKAN 511
            :|.|:|..|.|||.|:||||||||||||:     :.|.:..|...|.:|
 Frog   222 RRIEIAHSLCLSERQIKIWFQNRRMKWKKDHRLPNTKVRSNASSNASSN 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 34/52 (65%)
hoxc4XP_002936684.1 Homeobox 196..250 CDD:365835 35/53 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.