DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and LOC100486032

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_002934006.1 Gene:LOC100486032 / 100486032 -ID:- Length:255 Species:Xenopus tropicalis


Alignment Length:181 Identity:84/181 - (46%)
Similarity:108/181 - (59%) Gaps:30/181 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 PIP---PHSPIRPQDFPLYAGGHPYQLLAQGGSAFHRPLDPSGKPIPIPMGHNFMPSQLQFEFLA 415
            |:|   |.:||             |.|.:.|  |.|.....|....|...||..:.:.|..|...
 Frog    51 PLPGLYPTAPI-------------YHLPSLG--ATHPNYPYSSFSAPPASGHEHIKASLPLEHWL 100

  Fly   416 RAGMLHHRIPELAAYPHHAILGKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSE 480
            |||:|.||.|:|.|.....::||.||||||||||||||||.|||.|||||||||||||:.|||:|
 Frog   101 RAGLLLHRGPDLHASAQPGLMGKCRRPRTAFTSQQLLELENQFKANKYLSRPKRFEVATSLMLTE 165

  Fly   481 TQVKIWFQNRRMKWKRSKKAQQE------------AKERAKANQQQQQQQQ 519
            |||||||||||||||||:||:::            .|..:|.::::::.::
 Frog   166 TQVKIWFQNRRMKWKRSRKAKEQGPSEQGDRPRAGGKTLSKEDEEEEEDEE 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 47/52 (90%)
LOC100486032XP_002934006.1 Homeobox 127..181 CDD:365835 48/53 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 109 1.000 Domainoid score I6284
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm49451
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3748
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.