DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and Hoxb2

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_002727852.1 Gene:Hoxb2 / 100361765 RGDID:2319509 Length:355 Species:Rattus norvegicus


Alignment Length:197 Identity:69/197 - (35%)
Similarity:88/197 - (44%) Gaps:56/197 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 IPPHSPIRPQDFPLYAGGHPYQLLAQGGSAFHRP--LDPSG------KPIPIPMGHNFMPSQLQF 411
            |||..|...|.||         .|..|.|...||  ..|:|      .|.|:|:.    |...:|
  Rat    43 IPPPPPPLEQTFP---------SLQLGASTLQRPGSQKPAGDGPALRPPPPLPVA----PPAPEF 94

  Fly   412 EFL-----ARAGMLHHRIPELAA----------------YPHHAILGKTRRPRTAFTSQQLLELE 455
            .::     |:........|..||                .|.....| :||.|||:|:.||||||
  Rat    95 PWMKEKKSAKKPSQSAATPSPAASSVRASGVGSPSDGPGLPESGGSG-SRRLRTAYTNTQLLELE 158

  Fly   456 KQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKK-------------AQQEAKER 507
            |:|..||||.||:|.|:|:.|.|:|.|||:||||||||.||..:             ||.:|.|.
  Rat   159 KEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQHREPPDGEPGGLSAQDDAGEP 223

  Fly   508 AK 509
            |:
  Rat   224 AE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 35/52 (67%)
Hoxb2XP_002727852.1 Homeobox 146..198 CDD:278475 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.