DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and hoxc3

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_002936696.1 Gene:hoxc3 / 100190990 XenbaseID:XB-GENE-5997986 Length:394 Species:Xenopus tropicalis


Alignment Length:244 Identity:68/244 - (27%)
Similarity:103/244 - (42%) Gaps:77/244 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 SNAAAAAQAAASAAG------GISEQEALQRIRDSREYDSPSPDGMSRSESPTSSHRSSPPISPG 324
            :|.:|:.:...|..|      .:|||....:..:|   |||.|...| ::|.||...:.|..|..
 Frog    51 ANGSASHKGEHSIKGIDFHLSEVSEQAQQPKSPNS---DSPLPKSAS-TQSCTSKKSTGPVSSDV 111

  Fly   325 CEDQQQPHGALHPQHLS--MRMSDFHDEFKKPIPPHSPIRPQDFPLYAGGHPYQLLAQGGSAFHR 387
            ....::..|:..|:.:.  |:.:..:.:.||..||.:...|                        
 Frog   112 TSPNKKSKGSNMPKQIFPWMKETRQNSKQKKQAPPPADDAP------------------------ 152

  Fly   388 PLDPSGKPIPIPMGHNFMPSQLQFEFLARAGMLHHRIPELAAYPHHAILGKTRRPRTAFTSQQLL 452
            .:|.|                    ||:.|                     ::|.|||:|:.||:
 Frog   153 AVDSS--------------------FLSSA---------------------SKRARTAYTNSQLV 176

  Fly   453 ELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKKAQ 501
            ||||:|..|:||.||:|.|:|..|.|||.|:||||||||||:|:..|.:
 Frog   177 ELEKEFHFNRYLCRPRRLEMAKLLNLSERQIKIWFQNRRMKFKKDHKGK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 34/52 (65%)
hoxc3XP_002936696.1 Homeobox 167..220 CDD:395001 34/52 (65%)
DUF4074 335..392 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.