DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and hoxb5

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001094494.1 Gene:hoxb5 / 100113366 XenbaseID:XB-GENE-1005991 Length:258 Species:Xenopus tropicalis


Alignment Length:320 Identity:71/320 - (22%)
Similarity:111/320 - (34%) Gaps:109/320 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 SGAAAPPPVSPQPAANHLSHSGATMATTTLLPPAQSQPKKSFCIDALLAKSQHQSGEPQPIIVDD 244
            ||:......|.||:|...:::|..::.:.....:......:|...    :|:.::.:..|:...|
 Frog    33 SGSYREAAGSMQPSAYGYNYNGMDLSVSRAAASSSHYGDSAFPGQ----ESRFRANQSCPLATPD 93

  Fly   245 RLAALHYARDQAELNHAFVTASNAAAAAQAAASAAGGISEQEALQRIRDSREYDSPSPDGMSRSE 309
            .|......:|:........:|.::|...:...::|...:|:.:..|        |.:|       
 Frog    94 PLPCAKSHKDELSPTDPATSAGSSAQFTEVEETSASSETEESSTPR--------SSAP------- 143

  Fly   310 SPTSSHRSSPPISPGCEDQQQPHGALHPQHLSMRMSDFHDEFKKPIPPHSPIRPQDFPLYAGGHP 374
             |.:...:|.|.:.|.:.|                                 .||.||.....| 
 Frog   144 -PRALQENSSPGAAGTDGQ---------------------------------NPQIFPWMRKLH- 173

  Fly   375 YQLLAQGGSAFHRPLDPSGKPIPIPMGHNFMPSQLQFEFLARAGMLHHRIPELAAYPHHAILGKT 439
                     ..|....|.||                                             
 Frog   174 ---------INHDMTGPDGK--------------------------------------------- 184

  Fly   440 RRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKK 499
             |.|||:|..|.|||||:|..|:||:|.:|.|:|..|.|||.|:||||||||||||:..|
 Frog   185 -RARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 33/52 (63%)
hoxb5NP_001094494.1 Homeobox 187..240 CDD:365835 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.